TA344786 EIF5A2 antibody

Rabbit Polyclonal Anti-EIF5A2 Antibody - N-terminal region

See related secondary antibodies

Search for all "EIF5A2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat EIF5A2

Product Description for EIF5A2

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat EIF5A2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EIF5A2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Eukaryotic translation initiation factor 5A-2, eIF-5A-2, eIF-5A2
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZV4
Immunogen:
The immunogen for anti-EIF5A2 antibody: synthetic peptide directed towards the N terminal of human EIF5A2. Synthetic peptide located within the following region: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK.
GeneID:
56648
Application WB
Background EIF5A2 is a mR-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mR turnover, probably acting downstream of decapping.EIF5A2 is involved in actin dymics and cell cycle progression, mR decay and probably in a pathway involved in stress response and maintence of cell wall integrity. EIF5A2 functions as a regulator of apoptosis.EIF5A2 mediates effects of polyamines on neurol process extension and survival.EIF5A2 may play an important role in brain development and function, and in skeletal muscle stem cell differentiation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EIF5A2 (9 products)

Catalog No. Species Pres. Purity   Source  

EIF5A2

EIF5A2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

EIF5A2 (1-153, His-tag)

EIF5A2 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

EIF5A2 (1-153, His-tag)

EIF5A2 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

EIF5A2

EIF5A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF5A2

EIF5A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF5A2

EIF5A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF5A2

EIF5A2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF5A2

EIF5A2 Human Purified
  Novus Biologicals Inc.

EIF5A2

EIF5A2 Human Purified
  Novus Biologicals Inc.

Positive controls for EIF5A2 (3 products)

Catalog No. Species Pres. Purity   Source  

EIF5A2 293T Cell Transient Overexpression Lysate(Denatured)

EIF5A2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

eIF5A2 Lysate

Western Blot: eIF5A2 Lysate [NBL1-10215] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for EIF5A2.
  Novus Biologicals Inc.

EIF5A2 overexpression lysate

EIF5A2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn