TA344790 Carboxypeptidase A6 antibody

Rabbit Polyclonal Anti-CPA6 Antibody - middle region

See related secondary antibodies

Search for all "Carboxypeptidase A6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Mouse, Porcine, Rabbit, Rat Carboxypeptidase A6

Product Description for Carboxypeptidase A6

Rabbit anti Bovine, Equine, Mouse, Porcine, Rabbit, Rat Carboxypeptidase A6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Carboxypeptidase A6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CPA6, CPAH, Carboxypeptidase B
Presentation Purified
Reactivity Bov, Eq, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N4T0
Immunogen:
The immunogen for anti-CPA6 antibody: synthetic peptide directed towards the middle region of human CPA6. Synthetic peptide located within the following region: QSVYGVRYRYGPASTTLYVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFL.
GeneID:
57094
Application WB
Background The protein encoded by this gene belongs to the family of carboxypeptidases, which catalyze the release of C-termil amino acid, and have functions ranging from digestion of food to selective biosynthesis of neuroendocrine peptides. Polymorphic variants and a reciprocal translocation t(6;8)(q26;q13) involving this gene, have been associated with Duane retraction syndrome.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Carboxypeptidase A6 (3 products)

Catalog No. Species Pres. Purity   Source  

Carboxypeptidase A6 (full length, N-term HIS tag)

Carboxypeptidase A6 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Carboxypeptidase A6

Carboxypeptidase A6 Human Purified
  Abnova Taiwan Corp.

Carboxypeptidase A6

Carboxypeptidase A6 Human Purified
  Abnova Taiwan Corp.

Positive controls for Carboxypeptidase A6 (2 products)

Catalog No. Species Pres. Purity   Source  

CPA6 Lysate

Western Blot: CPA6 Lysate [NBL1-09428] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CPA6
  Novus Biologicals Inc.

CPA6 overexpression lysate

CPA6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn