TA344794 CASS4 antibody

Rabbit Polyclonal Anti-CASS4 Antibody - N-terminal region

See related secondary antibodies

Search for all "CASS4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CASS4

Product Description for CASS4

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CASS4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CASS4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf32, Cas scaffolding protein family member 4, HEF-like protein, HEF1-EFS-p130Cas-like protein, HEFL, HEPL
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQ75
Immunogen:
The immunogen for Anti-CASS4 antibody is: synthetic peptide directed towards the N-terminal region of Human CASS4. Synthetic peptide located within the following region: ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL.
GeneID:
57091
Application WB
Background CASS4 is a docking protein that plays a role in tyrosine kise-based sigling related to cell adhesion and cell spreading. It regulates PTK2/FAK1 activity, focal adhesion integrity, and cell spreading.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CASS4 (2 products)

Catalog No. Species Pres. Purity   Source  

CASS4

CASS4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CASS4

CASS4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CASS4 (1 products)

Catalog No. Species Pres. Purity   Source  

C20orf32 293T Cell Transient Overexpression Lysate(Denatured)

C20orf32 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn