TA344795 ANKMY2 antibody

Rabbit Polyclonal Anti-ANKMY2 Antibody - N-terminal region

See related secondary antibodies

Search for all "ANKMY2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Rabbit, Rat, Zebrafish ANKMY2

Product Description for ANKMY2

Rabbit anti Canine, Equine, Guinea Pig, Human, Rabbit, Rat, Zebrafish ANKMY2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ANKMY2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ankyrin repeat and MYND domain-containing protein 2
Presentation Purified
Reactivity Can, Eq, GP, Hu, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IV38
Immunogen:
The immunogen for anti-ANKMY2 antibody: synthetic peptide directed towards the N terminal of human ANKMY2. Synthetic peptide located within the following region: DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL.
GeneID:
57037
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ANKMY2 (3 products)

Catalog No. Species Pres. Purity   Source  

ANKMY2

ANKMY2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ANKMY2

ANKMY2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ANKMY2

ANKMY2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ANKMY2 (1 products)

Catalog No. Species Pres. Purity   Source  

ANKMY2 Lysate

Western Blot: ANKMY2 Lysate [NBL1-07531] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ANKMY2. Protein
  Novus Biologicals Inc.
  • LinkedIn