TA344797 PDXP antibody

Rabbit Polyclonal Anti-PDXP Antibody - middle region

See related secondary antibodies

Search for all "PDXP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Mouse, Rat PDXP

Product Description for PDXP

Rabbit anti Canine, Equine, Mouse, Rat PDXP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PDXP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PLP, PLP phosphatase, PLPP, Pyridoxal phosphate phosphatase
Presentation Purified
Reactivity Can, Eq, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96GD0
Immunogen:
The immunogen for anti-PDXP antibody: synthetic peptide directed towards the middle region of human PDXP. Synthetic peptide located within the following region: DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI.
GeneID:
57026
Application WB
Background Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 2003 [PubMed 14522954]).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PDXP (5 products)

Catalog No. Species Pres. Purity   Source  

PDXP (1-296, His-tag)

PDXP Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

PDXP (1-296, His-tag)

PDXP Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

PDXP

PDXP Human
  Abnova Taiwan Corp.

PDXP

PDXP Human Purified
  Novus Biologicals Inc.

PDXP

PDXP Human Purified
  Novus Biologicals Inc.
  • LinkedIn