TA344802 NT5M antibody

Rabbit Polyclonal Anti-NT5M Antibody - middle region

See related secondary antibodies

Search for all "NT5M"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NT5M

Product Description for NT5M

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NT5M.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NT5M

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 5'(3')-deoxyribonucleotidase, DNT2, mitochondrial
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NPB1
Immunogen:
The immunogen for anti-NT5M antibody: synthetic peptide directed towards the middle region of human NT5M. Synthetic peptide located within the following region: KYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHV.
GeneID:
56953
Application WB
Background This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromoso
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NT5M (4 products)

Catalog No. Species Pres. Purity   Source  

NT5M

NT5M Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NT5M (32-228, His-tag)

NT5M Human Purified > 95 % E. coli
50 µg / €820.00
  OriGene Technologies GmbH

NT5M (32-228, His-tag)

NT5M Human Purified > 95 % E. coli
10 µg / €320.00
  OriGene Technologies GmbH

NT5M

NT5M Human
  Abnova Taiwan Corp.

Positive controls for NT5M (2 products)

Catalog No. Species Pres. Purity   Source  

NT5M Lysate

Western Blot: NT5M Lysate [NBL1-13828] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NT5M
  Novus Biologicals Inc.

NT5M overexpression lysate

NT5M overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn