TA344807 GRIP1-associated protein 1 antibody

Rabbit Polyclonal Anti-GRIPAP1 Antibody - N-terminal region

See related secondary antibodies

Search for all "GRIP1-associated protein 1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human GRIP1-associated protein 1

Product Description for GRIP1-associated protein 1

Rabbit anti Bovine, Human GRIP1-associated protein 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GRIP1-associated protein 1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GRASP1, GRIPAP1, KIAA1167
Presentation Purified
Reactivity Bov, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4V328
Immunogen:
The immunogen for anti-GRIPAP1 antibody: synthetic peptide directed towards the N terminal of human GRIPAP1. Synthetic peptide located within the following region: ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV.
GeneID:
56850
Application WB
Background This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple altertively spliced transcript variants have been described that encode different protein isoforms; however, the full-length ture and biological validity of all of these variants have not been determined.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GRIP1-associated protein 1 (5 products)

Catalog No. Species Pres. Purity   Source  

GRIP1-associated protein 1 (transcript variant 1)

GRIP1-associated protein 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GRIP1-associated protein 1

GRIP1-associated protein 1 Human Purified
  Abnova Taiwan Corp.

GRIP1-associated protein 1

GRIP1-associated protein 1 Human Purified
  Abnova Taiwan Corp.

GRIP1-associated protein 1

GRIP1-associated protein 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GRIP1-associated protein 1

GRIP1-associated protein 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for GRIP1-associated protein 1 (3 products)

Catalog No. Species Pres. Purity   Source  

GRASP1 Lysate

Western Blot: GRASP1 Lysate [NBL1-11341] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GRIPAP1
  Novus Biologicals Inc.

GRIPAP1 293T Cell Transient Overexpression Lysate(Denatured)

GRIPAP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GRIPAP1 overexpression lysate

GRIPAP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn