TA344809 Ubiquilin-4 antibody

Rabbit Polyclonal Anti-UBQLN4 Antibody - middle region

See related secondary antibodies

Search for all "Ubiquilin-4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish Ubiquilin-4

Product Description for Ubiquilin-4

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish Ubiquilin-4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Ubiquilin-4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms A1Up, Ataxin-1 interacting ubiquitin-like protein, Ataxin-1 ubiquitin-like-interacting protein A1U, C1orf6, CIP75, Connexin43-interacting protein of 75 kDa, UBIN, UBQLN4
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NRR5
Immunogen:
The immunogen for anti-UBQLN4 antibody: synthetic peptide directed towards the middle region of human UBQLN4. Synthetic peptide located within the following region: TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS.
GeneID:
56893
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Ubiquilin-4 (1 products)

Catalog No. Species Pres. Purity   Source  

Ubiquilin-4

Ubiquilin-4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Ubiquilin-4 (2 products)

Catalog No. Species Pres. Purity   Source  

UBQLN4 Lysate

Western Blot:  UBQLN4  Lysate [NBL1-17566] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for  UBQLN4
  Novus Biologicals Inc.

UBQLN4 overexpression lysate

UBQLN4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn