TA344811 Follistatin-like protein 5 antibody

Rabbit Polyclonal Anti-FSTL5 Antibody - middle region

See related secondary antibodies

Search for all "Follistatin-like protein 5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rabbit, Rat, Zebrafish Follistatin-like protein 5

Product Description for Follistatin-like protein 5

Rabbit anti Human, Mouse, Rabbit, Rat, Zebrafish Follistatin-like protein 5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Follistatin-like protein 5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FSTL5, Follistatin-related protein 5, KIAA1263
Presentation Purified
Reactivity Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N475
Immunogen:
The immunogen for anti-FSTL5 antibody: synthetic peptide directed towards the middle region of human FSTL5. Synthetic peptide located within the following region: EAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKM.
GeneID:
56884
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Follistatin-like protein 5 (2 products)

Catalog No. Species Pres. Purity   Source  

Follistatin-like protein 5

Follistatin-like protein 5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Follistatin-like protein 5

Follistatin-like protein 5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Follistatin-like protein 5 (3 products)

Catalog No. Species Pres. Purity   Source  

FSTL5 293T Cell Transient Overexpression Lysate(Denatured)

FSTL5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FSTL5 Lysate

Western Blot: FSTL5 Lysate [NBL1-10849] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FSTL5
  Novus Biologicals Inc.

FSTL5 overexpression lysate

FSTL5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn