TA344814 EIF4ENIF1 / 4E-T antibody

Rabbit Polyclonal Anti-EIF4ENIF1 Antibody - N-terminal region

See related secondary antibodies

Search for all "EIF4ENIF1 / 4E-T"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EIF4ENIF1 / 4E-T

Product Description for EIF4ENIF1 / 4E-T

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EIF4ENIF1 / 4E-T.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EIF4ENIF1 / 4E-T

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Eukaryotic translation initiation factor 4E nuclear import factor 1, Eukaryotic translation initiation factor 4E transporter, eIF4E transporter
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NRA8
Immunogen:
The immunogen for anti-EIF4ENIF1 antibody: synthetic peptide directed towards the N terminal of human EIF4ENIF1. Synthetic peptide located within the following region: TEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGI.
GeneID:
56478
Application WB
Background The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predomintly cytoplasmic; its own nuclear import is regulated by a nuclear localization sigl and nuclear export sigls. Multiple transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EIF4ENIF1 / 4E-T (2 products)

Catalog No. Species Pres. Purity   Source  

EIF4ENIF1 / 4E-T

EIF4ENIF1 / 4E-T Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EIF4ENIF1 / 4E-T

EIF4ENIF1 / 4E-T Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for EIF4ENIF1 / 4E-T (1 products)

Catalog No. Species Pres. Purity   Source  

EIF4ENIF1 293T Cell Transient Overexpression Lysate(Denatured)

EIF4ENIF1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn