TA344816 IRGC antibody

Rabbit Polyclonal Anti-Irgc1 Antibody - N-terminal region

See related secondary antibodies

Search for all "IRGC"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse IRGC

Product Description for IRGC

Rabbit anti Mouse IRGC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IRGC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cinema 1, IIGP5, IRGC1, Immunity-related GTPase cinema 1, Interferon-inducible GTPase 5
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NXR0
Immunogen:
The immunogen for anti-Irgc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RGLGAEDPGAALTGVVETTMQPSPYPHPQFPDVTLWDLPGAGSPGCSADK.
GeneID:
56269
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IRGC (3 products)

Catalog No. Species Pres. Purity   Source  

IRGC

IRGC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

IRGC

IRGC Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IRGC

IRGC Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn