TA344818 LIN37 antibody

Rabbit Polyclonal Anti-LIN37 Antibody - middle region

See related secondary antibodies

Search for all "LIN37"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat LIN37

Product Description for LIN37

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat LIN37.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LIN37

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Antolefinin, Protein lin-37 homolog
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96GY3
Immunogen:
The immunogen for anti-LIN37 antibody: synthetic peptide directed towards the middle region of human LIN37. Synthetic peptide located within the following region: HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR.
GeneID:
55957
Application WB
Background This gene encodes a protein expressed in the eye.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for LIN37 (2 products)

Catalog No. Species Pres. Purity   Source  

LIN37 Lysate

Western Blot: LIN37 Lysate [NBL1-12542] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LIN37
  Novus Biologicals Inc.

LIN37 overexpression lysate

LIN37 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn