TA344820 CCDC76 antibody

Rabbit Polyclonal Anti-CCDC76 Antibody - N-terminal region

See related secondary antibodies

Search for all "CCDC76"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CCDC76

Product Description for CCDC76

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CCDC76.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CCDC76

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Coiled-coil domain-containing protein 76, tRNA [Gm4] methyltransferase, tRNA guanosine-2'-O-methyltransferase TRM13 homolog, tRNA methyltransferase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUP7
Immunogen:
The immunogen for anti-CCDC76 antibody: synthetic peptide directed towards the N terminal of human CCDC76. Synthetic peptide located within the following region: QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE.
GeneID:
54482
Application WB
Background CCDC76 specifically methylates guanosine-4 in various tRs with a Gly(CCG), His or Pro sigture.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CCDC76 (2 products)

Catalog No. Species Pres. Purity   Source  

CCDC76

CCDC76 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCDC76

CCDC76 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CCDC76 (2 products)

Catalog No. Species Pres. Purity   Source  

CCDC76 293T Cell Transient Overexpression Lysate(Denatured)

CCDC76 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRMT13 overexpression lysate

TRMT13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn