TA344823 EXOC6 / SEC15A antibody

Rabbit Polyclonal Anti-EXOC6 Antibody - middle region

See related secondary antibodies

Search for all "EXOC6 / SEC15A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish EXOC6 / SEC15A

Product Description for EXOC6 / SEC15A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish EXOC6 / SEC15A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EXOC6 / SEC15A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Exocyst complex component 6, SEC15-like protein 1, SEC15L, SEC15L1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TAG9
Immunogen:
The immunogen for anti-EXOC6 antibody: synthetic peptide directed towards the middle region of human EXOC6. Synthetic peptide located within the following region: YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT.
GeneID:
54536
Application WB
Background The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Altertively spliced transcript variants encoding different isoforms have been identified.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EXOC6 / SEC15A (1 products)

Catalog No. Species Pres. Purity   Source  

EXOC6 / SEC15A (transcript variant 1)

EXOC6 / SEC15A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for EXOC6 / SEC15A (1 products)

Catalog No. Species Pres. Purity   Source  

EXOC6 Lysate

Western Blot: EXOC6 Lysate [NBL1-10381] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for EXOC6.
  Novus Biologicals Inc.
  • LinkedIn