TA344825 APBB1IP antibody

Rabbit Polyclonal Anti-APBB1IP Antibody - N-terminal region

See related secondary antibodies

Search for all "APBB1IP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat APBB1IP

Product Description for APBB1IP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat APBB1IP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for APBB1IP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms APBB1-interacting protein 1, Amyloid beta A4 precursor protein-binding family B member 1-interacting protein, PREL1, Proline-rich EVH1 ligand 1, Proline-rich protein 73, RARP1, RIAM, Rap1-GTP-interacting adapter molecule, Retinoic acid-responsive proline-rich protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z5R6
Immunogen:
The immunogen for anti-APBB1IP antibody: synthetic peptide directed towards the N terminal of human APBB1IP. Synthetic peptide located within the following region: LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG.
GeneID:
54518
Application WB
Background APBB1IP appears to function in the sigl transduction from Ras activation to actin cytoskeletal remodeling. APBB1IP suppresses insulin-induced promoter activities through AP1 and SRE. APBB1IP mediates Rap1-induced adhesion.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for APBB1IP (6 products)

Catalog No. Species Pres. Purity   Source  

APBB1IP

APBB1IP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

APBB1IP

APBB1IP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

APBB1IP

APBB1IP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

APBB1IP

APBB1IP Human Purified
  Abnova Taiwan Corp.

APBB1IP

APBB1IP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

APBB1IP

APBB1IP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for APBB1IP (1 products)

Catalog No. Species Pres. Purity   Source  

APBB1IP overexpression lysate

APBB1IP overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn