TA344828 SASH3 antibody

Rabbit Polyclonal Anti-CXorf9 Antibody - C-terminal region

See related secondary antibodies

Search for all "SASH3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SASH3

Product Description for SASH3

Rabbit anti Human SASH3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SASH3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CXorf9, SAM and SH3 domain-containing protein 3, SH3 protein expressed in lymphocytes homolog, SLY
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75995
Immunogen:
The immunogen for anti-CXorf9 antibody: synthetic peptide directed towards the C terminal of human CXorf9. Synthetic peptide located within the following region: RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRET.
GeneID:
54440
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SASH3 (1 products)

Catalog No. Species Pres. Purity   Source  

SASH3

SASH3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for SASH3 (2 products)

Catalog No. Species Pres. Purity   Source  

SASH3 Lysate

Western Blot: SASH3 Lysate [NBL1-15697] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SASH3
  Novus Biologicals Inc.

SASH3 overexpression lysate

SASH3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn