TA344830 GFOD1 antibody

Rabbit Polyclonal Anti-GFOD1 Antibody - middle region

See related secondary antibodies

Search for all "GFOD1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish GFOD1

Product Description for GFOD1

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish GFOD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GFOD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Glucose-fructose oxidoreductase domain-containing protein 1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NXC2
Immunogen:
The immunogen for anti-GFOD1 antibody: synthetic peptide directed towards the middle region of human GFOD1. Synthetic peptide located within the following region: NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT.
GeneID:
54438
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GFOD1 (3 products)

Catalog No. Species Pres. Purity   Source  

GFOD1

GFOD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GFOD1

GFOD1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GFOD1

GFOD1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for GFOD1 (2 products)

Catalog No. Species Pres. Purity   Source  

GFOD1 293T Cell Transient Overexpression Lysate(Denatured)

GFOD1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GFOD1 overexpression lysate

GFOD1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn