TA344845 NOLA3 antibody

Rabbit Polyclonal Anti-NOLA3 Antibody - middle region

See related secondary antibodies

Search for all "NOLA3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NOLA3

Product Description for NOLA3

Rabbit anti Human NOLA3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NOLA3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms H/ACA ribonucleoprotein complex subunit 3, NOP10
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NPE3
Immunogen:
The immunogen for anti-NOLA3 antibody: synthetic peptide directed towards the middle region of human NOLA3. Synthetic peptide located within the following region: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK.
GeneID:
55505
Application WB
Background This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rR processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NOLA3 (3 products)

Catalog No. Species Pres. Purity   Source  

NOLA3 (full length, N-term HIS tag)

NOLA3 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

NOLA3

NOLA3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NOLA3

NOLA3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NOLA3 (1 products)

Catalog No. Species Pres. Purity   Source  

NOP10 overexpression lysate

NOP10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn