TA344846 DNAJA4 antibody

Rabbit Polyclonal Anti-MST104 Antibody - C-terminal region

See related secondary antibodies

Search for all "DNAJA4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human DNAJA4

Product Description for DNAJA4

Rabbit anti Human DNAJA4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DNAJA4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DnaJ homolog subfamily A member 4
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WW22
Immunogen:
The immunogen for Anti-MST104 antibody is: synthetic peptide directed towards the C-terminal region of Human MST104. Synthetic peptide located within the following region: EKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKE.
GeneID:
55466
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DNAJA4 (2 products)

Catalog No. Species Pres. Purity   Source  

DNAJA4

DNAJA4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DNAJA4

DNAJA4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DNAJA4 (1 products)

Catalog No. Species Pres. Purity   Source  

DNAJA4 293T Cell Transient Overexpression Lysate(Denatured)

DNAJA4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn