TA344850 LRDD / PIDD antibody

Rabbit Polyclonal Anti-LRDD Antibody - middle region

See related secondary antibodies

Search for all "LRDD / PIDD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LRDD / PIDD

Product Description for LRDD / PIDD

Rabbit anti Human LRDD / PIDD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LRDD / PIDD

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Leucine-rich repeat and death domain-containing protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HB75-3
Immunogen:
The immunogen for anti-LRDD antibody: synthetic peptide directed towards the middle region of human LRDD. Synthetic peptide located within the following region: RRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFE.
GeneID:
55367
Application WB
Background The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kise activating death domain-containing protein (MADD), and thus may function as an adaptor protein in cell death-related sigling processes. The expression of the mouse counterpart of this gene has been found to be positively regulated by the tumor suppressor p53 and to induce cell apoptosis in response to D damage, which suggests a role for this gene as an effector of p53-dependent apoptosis. Three altertively spliced transcript variants encoding distinct isoforms have been reported.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn