TA344851 LRDD / PIDD antibody

Rabbit Polyclonal Anti-LRDD Antibody - N-terminal region

See related secondary antibodies

Search for all "LRDD / PIDD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LRDD / PIDD

Product Description for LRDD / PIDD

Rabbit anti Human LRDD / PIDD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LRDD / PIDD

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Leucine-rich repeat and death domain-containing protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HB75-3
Immunogen:
The immunogen for anti-LRDD antibody: synthetic peptide directed towards the N terminal of human LRDD. Synthetic peptide located within the following region: RLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLA.
GeneID:
55367
Application WB
Background The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kise activating death domain-c
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn