TA344852 ACTR10 antibody

Rabbit Polyclonal Anti-ACTR10 Antibody - middle region

See related secondary antibodies

Search for all "ACTR10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ACTR10

Product Description for ACTR10

Rabbit anti Human ACTR10.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ACTR10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ACTR11, ARP11, Actin-related protein 10
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZ32
Immunogen:
Synthetic peptide directed towards the middle region of human ACTR10
AA Sequence:
SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL
GeneID:
55860
Application Western blotting (0.2 - 1.0 µg/ml)
Background Actin-related protein 10 is a cytoskeleton protein belonging to the actin family. The function of this 417 amino acid and 46 kDa protein is still unknown.
General Readings "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. expand/collapse author list Chen J.-L. Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Chicken, Rat, Guinea Pig, Dog, Xenopus, Zebrafish
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ACTR10 (2 products)

Catalog No. Species Pres. Purity   Source  

ACTR10

ACTR10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACTR10

ACTR10 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ACTR10 (3 products)

Catalog No. Species Pres. Purity   Source  

ACTR10 Lysate(Denatured)

ACTR10 Lysate(Denatured)
  Abnova Taiwan Corp.

ACTR10 Lysate

Western Blot: ACTR10 Lysate [NBL1-07284] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACTR10 Protein
  Novus Biologicals Inc.

ACTR10 overexpression lysate

ACTR10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn