TA344855 ARHGAP15 antibody

Rabbit Polyclonal Anti-ARHGAP15 Antibody - middle region

See related secondary antibodies

Search for all "ARHGAP15"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Mouse, Rabbit ARHGAP15

TA344855

More Views

  • TA344855

Product Description for ARHGAP15

Rabbit anti Canine, Equine, Guinea Pig, Mouse, Rabbit ARHGAP15.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARHGAP15

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BM-024, BM-030, BM-046, Rho GTPase-activating protein 15, Rho-type GTPase-activating protein 15
Presentation Purified
Reactivity Can, Eq, GP, Ms, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q53QZ3
Immunogen:
The immunogen for anti-ARHGAP15 antibody: synthetic peptide directed towards the middle region of human ARHGAP15. Synthetic peptide located within the following region: VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ.
GeneID:
55843
Application WB
Background RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ARHGAP15 (3 products)

Catalog No. Species Pres. Purity   Source  

ARHGAP15

ARHGAP15 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ARHGAP15

ARHGAP15 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ARHGAP15

ARHGAP15 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ARHGAP15 (3 products)

Catalog No. Species Pres. Purity   Source  

ARHGAP15 293T Cell Transient Overexpression Lysate(Denatured)

ARHGAP15 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ARHGAP15 Lysate

Western Blot: ARHGAP15 Lysate [NBL1-07666] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ARHGAP15 Protein
  Novus Biologicals Inc.

ARHGAP15 overexpression lysate

ARHGAP15 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn