TA344858 PRR13 antibody

Rabbit Polyclonal Anti-PRR13 Antibody - N-terminal region

See related secondary antibodies

Search for all "PRR13"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse PRR13

Product Description for PRR13

Rabbit anti Bovine, Canine, Human, Mouse PRR13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRR13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BM-041, Proline-rich protein 13, TXR1, Taxane-resistance protein
Presentation Purified
Reactivity Bov, Can, Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZ81
Immunogen:
The immunogen for anti-PRR13 antibody: synthetic peptide directed towards the N terminal of human PRR13. Synthetic peptide located within the following region: MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHG.
GeneID:
54458
Application WB
Background PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PRR13 (4 products)

Catalog No. Species Pres. Purity   Source  

PRR13 (transcript variant 2)

PRR13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PRR13

PRR13 Human
  Abnova Taiwan Corp.

PRR13

PRR13 Human
  Abnova Taiwan Corp.

PRR13

PRR13 Human
  Abnova Taiwan Corp.

Positive controls for PRR13 (1 products)

Catalog No. Species Pres. Purity   Source  

PRR13 Lysate

Western Blot: PRR13 Lysate [NBL1-14832] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PRR13
  Novus Biologicals Inc.
  • LinkedIn