TA344859 CENP-N antibody

Rabbit Polyclonal Anti-CENPN Antibody - middle region

See related secondary antibodies

Search for all "CENP-N"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat CENP-N

TA344859

More Views

  • TA344859
  • TA344859
  • TA344859
  • TA344859

Product Description for CENP-N

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat CENP-N.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for CENP-N

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BM-309, BM309, C16orf60, CENPN, Centromere protein N, ICEN32
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rb, Rt
Applications ICC/IF, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96H22
Immunogen:
The immunogen for anti-CENPN antibody: synthetic peptide directed towards the middle region of human CENPN. Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS.
GeneID:
55839
Application WB
IF
Background The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additiol factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CENP-N (2 products)

Catalog No. Species Pres. Purity   Source  

CENP-N

CENP-N Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CENP-N

CENP-N Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CENP-N (4 products)

Catalog No. Species Pres. Purity   Source  

CENPN Lysate

Western Blot: CENPN Lysate [NBL1-09089] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CENPN
  Novus Biologicals Inc.

CENPN overexpression lysate

CENPN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CENPN overexpression lysate

CENPN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CENPN overexpression lysate

CENPN overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn