TA344862 SPATA7 / HSD3 antibody

Rabbit Polyclonal Anti-SPATA7 Antibody - middle region

See related secondary antibodies

Search for all "SPATA7 / HSD3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SPATA7 / HSD3

TA344862

More Views

  • TA344862
  • TA344862
  • TA344862

Product Description for SPATA7 / HSD3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SPATA7 / HSD3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPATA7 / HSD3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HSD-3.1, Spermatogenesis-associated protein 7
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P0W8
Immunogen:
The immunogen for anti-SPATA7 antibody: synthetic peptide directed towards the middle region of human SPATA7. Synthetic peptide located within the following region: FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN.
GeneID:
55812
Application WB
Background The function of the SPATA7 protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SPATA7 / HSD3 (3 products)

Catalog No. Species Pres. Purity   Source  

SPATA7 / HSD3 (transcript variant 2)

SPATA7 / HSD3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SPATA7 / HSD3

SPATA7 / HSD3 Human Purified
  Abnova Taiwan Corp.

SPATA7 / HSD3

SPATA7 / HSD3 Human Purified
  Abnova Taiwan Corp.

Positive controls for SPATA7 / HSD3 (2 products)

Catalog No. Species Pres. Purity   Source  

SPATA7 Lysate

Western Blot: SPATA7 Lysate [NBL1-16384] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SPATA7
  Novus Biologicals Inc.

SPATA7 overexpression lysate

SPATA7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn