TA344863 TCP11L1 antibody

Rabbit Polyclonal Anti-TCP11L1 Antibody - C-terminal region

See related secondary antibodies

Search for all "TCP11L1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TCP11L1

Product Description for TCP11L1

Rabbit anti Human TCP11L1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TCP11L1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms T-complex protein 11-like protein 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUJ3
Immunogen:
The immunogen for Anti-TCP11L1 antibody is: synthetic peptide directed towards the C-terminal region of Human TCP11L1. Synthetic peptide located within the following region: GQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRE.
GeneID:
55346
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TCP11L1 (1 products)

Catalog No. Species Pres. Purity   Source  

TCP11L1 (transcript variant 2)

TCP11L1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TCP11L1 (2 products)

Catalog No. Species Pres. Purity   Source  

TCP11L1 Lysate

Western Blot: TCP11L1 Lysate [NBL1-16789] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TCP11L1
  Novus Biologicals Inc.

TCP11L1 overexpression lysate

TCP11L1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn