TA344872 FTSJD1 antibody

Rabbit Polyclonal Anti-FTSJD1 Antibody - middle region

See related secondary antibodies

Search for all "FTSJD1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Rabbit, Rat FTSJD1

Product Description for FTSJD1

Rabbit anti Bovine, Canine, Guinea Pig, Rabbit, Rat FTSJD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FTSJD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AFT, FtsJ methyltransferase domain-containing protein 1, Protein adrift homolog
Presentation Purified
Reactivity Bov, Can, GP, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IYT2
Immunogen:
The immunogen for anti-FTSJD1 antibody: synthetic peptide directed towards the middle region of human FTSJD1. Synthetic peptide located within the following region: TKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSS.
GeneID:
55783
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn