TA344879 BXDC2 antibody

Rabbit Polyclonal Anti-BXDC2 Antibody - middle region

See related secondary antibodies

Search for all "BXDC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Zebrafish BXDC2

Product Description for BXDC2

Rabbit anti Human, Zebrafish BXDC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BXDC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Brix domain-containing protein 2, Ribosome biogenesis protein Brix
Presentation Purified
Reactivity Hu, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TDN6
Immunogen:
The immunogen for anti-BXDC2 antibody: synthetic peptide directed towards the middle region of human BXDC2. Synthetic peptide located within the following region: IWFRNFQIIEEDAALVEIGPRFVLNLIKIFQGSFGGPTLYENPHYQSPNM.
GeneID:
55299
Application WB
Background BXDC2 is required for biogenesis of the 60S ribosomal subunit.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for BXDC2 (3 products)

Catalog No. Species Pres. Purity   Source  

BRIX1 overexpression lysate

BRIX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

BRIX 293T Cell Transient Overexpression Lysate(Denatured)

BRIX 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

BXDC2 Lysate

Western Blot: BXDC2 Lysate [NBL1-08062] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for BRIX1. Protein
  Novus Biologicals Inc.
  • LinkedIn