TA344882 TDP1 antibody

Rabbit Polyclonal Anti-TDP1 Antibody - middle region

See related secondary antibodies

Search for all "TDP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit TDP1

Product Description for TDP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit TDP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TDP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Tyrosyl-DNA phosphodiesterase 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUW8
Immunogen:
The immunogen for anti-Tdp1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF.
GeneID:
55775
Application WB
Background Tdp1 is a D repair enzyme that can remove a variety of covalent adducts from D through hydrolysis of a 3'-phosphodiester bond, giving rise to D with a free 3' phosphate. It catalyzes the hydrolysis of dead-end complexes between D and the topoisomerase I active site tyrosine residue. It hydrolyzes 3'-phosphoglycolates on protruding 3' ends on D double-strand breaks due to D damage by radiation and free radicals. It acts on blunt-ended double-strand D breaks and on single-stranded D. It has low 3'exonuclease activity and can remove a single nucleoside from the 3'end of D and R molecules with 3'hydroxyl groups. It has no exonuclease activity towards D or R with a 3'phosphate.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TDP1 (6 products)

Catalog No. Species Pres. Purity   Source  

TDP1 (transcript variant 2)

TDP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TDP1 (transcript variant 1)

TDP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TDP1

TDP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TDP1

TDP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TDP1

TDP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TDP1

TDP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TDP1 (2 products)

Catalog No. Species Pres. Purity   Source  

TDP1 293T Cell Transient Overexpression Lysate(Denatured)

TDP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TDP1 Lysate

Western Blot: TDP1 Lysate [NBL1-16800] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TDP1
  Novus Biologicals Inc.
  • LinkedIn