TA344885 UEVLD antibody

Rabbit Polyclonal Anti-UEVLD Antibody - N-terminal region

See related secondary antibodies

Search for all "UEVLD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat UEVLD

Product Description for UEVLD

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat UEVLD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UEVLD

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EV and lactate/malate dehydrogenase domain-containing protein, UEV-3, UEV3, Ubiquitin-conjugating enzyme E2 variant 3
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IX04
Immunogen:
The immunogen for anti-UEVLD antibody: synthetic peptide directed towards the N terminal of human UEVLD. Synthetic peptide located within the following region: FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP.
GeneID:
55293
Application WB
Background UEVLD is a possible negative regulator of polyubiquitition.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UEVLD (4 products)

Catalog No. Species Pres. Purity   Source  

UEVLD

UEVLD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UEVLD

UEVLD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UEVLD

UEVLD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UEVLD

UEVLD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for UEVLD (2 products)

Catalog No. Species Pres. Purity   Source  

UEVLD 293T Cell Transient Overexpression Lysate(Denatured)

UEVLD 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

UEVLD Lysate

Western Blot: UEVLD Lysate [NBL1-17585] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UEVLD
  Novus Biologicals Inc.
  • LinkedIn