TA344896 AGK / MULK antibody

Rabbit Polyclonal Anti-AGK Antibody - N-terminal region

See related secondary antibodies

Search for all "AGK / MULK"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat AGK / MULK

Product Description for AGK / MULK

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat AGK / MULK.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AGK / MULK

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acylglycerol kinase, Multiple substrate lipid kinase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q53H12
Immunogen:
The immunogen for anti-AGK antibody: synthetic peptide directed towards the N terminal of human AGK. Synthetic peptide located within the following region: KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE.
GeneID:
55750
Application WB
Background AGK is a lipid kise that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. AGK does not phosphorylate sphingosine. Overexpression of AGK increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK sigling pathway, leading to increased cell growth.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AGK / MULK (4 products)

Catalog No. Species Pres. Purity   Source  

AGK / MULK

AGK / MULK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AGK / MULK

AGK / MULK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AGK / MULK

AGK / MULK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AGK / MULK

AGK / MULK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for AGK / MULK (1 products)

Catalog No. Species Pres. Purity   Source  

AGK / MULK Lysate(Denatured)

AGK / MULK Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn