TA344900 RNPEPL1 antibody

Rabbit Polyclonal Anti-RNPEPL1 Antibody - N-terminal region

See related secondary antibodies

Search for all "RNPEPL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Mouse, Porcine RNPEPL1

Product Description for RNPEPL1

Rabbit anti Bovine, Canine, Guinea Pig, Mouse, Porcine RNPEPL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNPEPL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Arginyl aminopeptidase-like 1, RNPEP-like 1
Presentation Purified
Reactivity Bov, Can, GP, Ms, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HAU8
Immunogen:
The immunogen for anti-RNPEPL1 antibody: synthetic peptide directed towards the N terminal of human RNPEPL1. Synthetic peptide located within the following region: LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD.
GeneID:
57140
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNPEPL1 (3 products)

Catalog No. Species Pres. Purity   Source  

RNPEPL1

RNPEPL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RNPEPL1

RNPEPL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNPEPL1

RNPEPL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for RNPEPL1 (2 products)

Catalog No. Species Pres. Purity   Source  

RNPEPL1 293T Cell Transient Overexpression Lysate(Denatured)

RNPEPL1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RNPEPL1 overexpression lysate

RNPEPL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn