TA344905 PANK4 antibody

Rabbit Polyclonal Anti-PANK4 Antibody - middle region

See related secondary antibodies

Search for all "PANK4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish PANK4

Product Description for PANK4

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish PANK4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PANK4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DKFZp547M242, FLJ10782, Pantothenate kinase 4, Pantothenic acid kinase 4
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NVE7
Immunogen:
The immunogen for anti-PANK4 antibody: synthetic peptide directed towards the middle region of human PANK4. Synthetic peptide located within the following region: LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD.
GeneID:
55229
Application WB
Background This gene encodes a protein belonging to the pantothete kise family. Pantothete kise is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynt
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PANK4 (4 products)

Catalog No. Species Pres. Purity   Source  

PANK4

PANK4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PANK4

PANK4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PANK4

PANK4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PANK4

PANK4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PANK4 (1 products)

Catalog No. Species Pres. Purity   Source  

PANK4 293T Cell Transient Overexpression Lysate(Denatured)

PANK4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn