TA344907 PNMAL1 antibody

Rabbit Polyclonal Anti-PNMAL1 Antibody - middle region

See related secondary antibodies

Search for all "PNMAL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PNMAL1

Product Description for PNMAL1

Rabbit anti Human PNMAL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PNMAL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PNMA-like protein 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86V59
Immunogen:
The immunogen for anti-PNMAL1 antibody: synthetic peptide directed towards the middle region of human PNMAL1. Synthetic peptide located within the following region: APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ.
GeneID:
55228
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for PNMAL1 (3 products)

Catalog No. Species Pres. Purity   Source  

PNMAL1 overexpression lysate

PNMAL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PNMAL1 overexpression lysate

PNMAL1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

PNMA-like 1 Lysate

Western Blot: PNMA-like 1 Lysate [NBL1-14549] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PNMAL1
  Novus Biologicals Inc.
  • LinkedIn