TA344908 ENAH / MENA antibody

Rabbit Polyclonal Anti-ENAH Antibody - C-terminal region

See related secondary antibodies

Search for all "ENAH / MENA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse ENAH / MENA

Product Description for ENAH / MENA

Rabbit anti Human, Mouse ENAH / MENA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ENAH / MENA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein enabled homolog
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N8S7
Immunogen:
The immunogen for Anti-Enah antibody is: synthetic peptide directed towards the C-terminal region of Mouse Enah. Synthetic peptide located within the following region: RRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNG.
GeneID:
55740
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ENAH / MENA (4 products)

Catalog No. Species Pres. Purity   Source  

ENAH / MENA (transcript variant 1)

ENAH / MENA Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ENAH / MENA (transcript variant 2)

ENAH / MENA Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ENAH / MENA

ENAH / MENA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ENAH / MENA

ENAH / MENA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ENAH / MENA (1 products)

Catalog No. Species Pres. Purity   Source  

ENAH overexpression lysate

ENAH overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn