TA344918 ARL8B / ARL10C antibody

Rabbit Polyclonal Anti-ARL8B Antibody - middle region

See related secondary antibodies

Search for all "ARL8B / ARL10C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish ARL8B / ARL10C

Product Description for ARL8B / ARL10C

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish ARL8B / ARL10C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARL8B / ARL10C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADP-ribosylation factor-like protein 10C, ADP-ribosylation factor-like protein 8B, GIE1, Novel small G protein indispensable for equal chromosome segregation 1
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NVJ2
Immunogen:
The immunogen for anti-ARL8B antibody: synthetic peptide directed towards the middle region of human ARL8B. Synthetic peptide located within the following region: DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL.
GeneID:
55207
Application WB
Background ARL8B may play a role in lysosome motility and chromosome segregation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ARL8B / ARL10C (1 products)

Catalog No. Species Pres. Purity   Source  

ARL8B / ARL10C

ARL8B / ARL10C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for ARL8B / ARL10C (1 products)

Catalog No. Species Pres. Purity   Source  

ARL8B Lysate

Western Blot: ARL8B Lysate [NBL1-07704] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ARL8B Protein
  Novus Biologicals Inc.
  • LinkedIn