TA344919 C12orf11 antibody

Rabbit Polyclonal Anti-C12orf11 Antibody - middle region

See related secondary antibodies

Search for all "C12orf11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Rabbit C12orf11

Product Description for C12orf11

Rabbit anti Rabbit C12orf11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C12orf11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cell cycle regulator Mat89Bb homolog, NY-SAR-95, Sarcoma antigen NY-SAR-95
Presentation Purified
Reactivity Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NVM9
Immunogen:
The immunogen for anti-C12orf11 antibody: synthetic peptide directed towards the middle region of human C12orf11. Synthetic peptide located within the following region: VQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH.
GeneID:
55726
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C12orf11 (1 products)

Catalog No. Species Pres. Purity   Source  

C12orf11

C12orf11 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C12orf11 (1 products)

Catalog No. Species Pres. Purity   Source  

ASUN overexpression lysate

ASUN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn