TA344921 Synembryn-B / RIC8B antibody

Rabbit Polyclonal Anti-RIC8B Antibody - middle region

See related secondary antibodies

Search for all "Synembryn-B / RIC8B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Synembryn-B / RIC8B

Product Description for Synembryn-B / RIC8B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Synembryn-B / RIC8B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Synembryn-B / RIC8B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Brain synembrin, Protein Ric-8B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NVN3
Immunogen:
The immunogen for anti-RIC8B antibody: synthetic peptide directed towards the middle region of human RIC8B. Synthetic peptide located within the following region: HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL.
GeneID:
55188
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Synembryn-B / RIC8B (1 products)

Catalog No. Species Pres. Purity   Source  

Synembryn-B / RIC8B

Synembryn-B / RIC8B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.
  • LinkedIn