TA344922 ABC2 / SMG8 antibody

Rabbit Polyclonal Anti-C17orf71 Antibody - middle region

See related secondary antibodies

Search for all "ABC2 / SMG8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ABC2 / SMG8

TA344922

More Views

  • TA344922
  • TA344922
  • TA344922
  • TA344922
  • TA344922

Product Description for ABC2 / SMG8

Rabbit anti Human ABC2 / SMG8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ABC2 / SMG8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Amplified in breast cancer gene 2 protein, UPF0487 protein C17orf71
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8ND04
Immunogen:
Synthetic peptide directed towards the middle region of human SMG8.
AA Sequence:
HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF
GeneID:
55181
Application

Western blotting  (0.2 -1 µg/ml).

Background ABC2 or SMG8 is involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. It ss recruited by release factors to stalled ribosomes together with SMG1 and SMG9 (forming the SMG1C protein kinase complex) and, in the SMG1C complex, is required to mediate the recruitment of SMG1 to the ribosome:SURF complex and to suppress SMG1 kinase activity until the ribosome:SURF complex locates the exon junction complex (EJC). SMG8 acts as a regulator of kinase activity.
General Readings "SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay." Yamashita A., Izumi N., Kashima I., Ohnishi T., Saari B., Katsuhata Y., Muramatsu R., Morita T., Iwamatsu A., Hachiya T., Kurata R., Hirano H., Anderson P., Ohno S. Genes Dev. 23:1091-1105(2009)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for ABC2 / SMG8 (1 products)

Catalog No. Species Pres. Purity   Source  

ABC2 / SMG8

ABC2 / SMG8 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Positive controls for ABC2 / SMG8 (1 products)

Catalog No. Species Pres. Purity   Source  

SMG8 overexpression lysate

SMG8 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn