TA344925 CENP-Q antibody

Rabbit Polyclonal Anti-CENPQ Antibody - N-terminal region

See related secondary antibodies

Search for all "CENP-Q"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CENP-Q

TA344925

More Views

  • TA344925
  • TA344925
  • TA344925
  • TA344925
  • TA344925

Product Description for CENP-Q

Rabbit anti Human CENP-Q.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CENP-Q

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6orf139, CENPQ, Centromere protein Q, chromosome 6 open reading frame 139
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7L2Z9
Immunogen:
The immunogen for anti-CENPQ antibody: synthetic peptide directed towards the N terminal of human CENPQ. Synthetic peptide located within the following region: VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL.
GeneID:
55166
Application WB
Background CENPQ is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CENP-Q (5 products)

Catalog No. Species Pres. Purity   Source  

CENP-Q (full length, N-term HIS tag)

CENP-Q Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

CENP-Q (His-tag)

CENP-Q Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

CENP-Q (His-tag)

CENP-Q Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

CENP-Q

CENP-Q Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CENP-Q

CENP-Q Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CENP-Q (2 products)

Catalog No. Species Pres. Purity   Source  

CENP-Q Lysate

Western Blot: C6orf139 Lysate [NBL1-09092] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CENPQ
  Novus Biologicals Inc.

CENPQ overexpression lysate

CENPQ overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn