TA344926 SHQ1 antibody

Rabbit Polyclonal Anti-SHQ1 Antibody - N-terminal region

See related secondary antibodies

Search for all "SHQ1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse SHQ1

Product Description for SHQ1

Rabbit anti Human, Mouse SHQ1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SHQ1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein SHQ1 homolog
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PI26
Immunogen:
The immunogen for Anti-Shq1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Shq1. Synthetic peptide located within the following region: PYFLRLTLPGRIVENGSEQGTYDADKGIFTIRLPKETPGQHFEGLNMLTA.
GeneID:
55164
Application WB
Background Shq1 is required for the quantitative accumulation of H/ACA ribonucleoproteins (RNPs), including telomerase, probably through the stabilization of DKC1, from the time of its synthesis until its association with NOP10, NHP2, and F1 at the scent H/ACA R.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SHQ1 (3 products)

Catalog No. Species Pres. Purity   Source  

SHQ1

SHQ1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SHQ1

SHQ1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SHQ1

SHQ1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SHQ1 (1 products)

Catalog No. Species Pres. Purity   Source  

SHQ1 overexpression lysate

SHQ1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn