TA344931 MAP7D1 antibody

Rabbit Polyclonal Anti-MAP7D1 Antibody - N-terminal region

See related secondary antibodies

Search for all "MAP7D1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat, Zebrafish MAP7D1

TA344931

More Views

  • TA344931

Product Description for MAP7D1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat, Zebrafish MAP7D1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MAP7D1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Arginine/proline-rich coiled-coil domain-containing protein 1, KIAA1187, MAP7 domain-containing protein 1, PARCC1, Proline/arginine-rich coiled-coil domain-containing protein 1, RPRC1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3KQU3
Immunogen:
The immunogen for anti-MAP7D1 antibody: synthetic peptide directed towards the N terminal of human MAP7D1. Synthetic peptide located within the following region: RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ.
GeneID:
55700
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn