TA344932 GPN2 / ATPBD1B antibody

Rabbit Polyclonal Anti-GPN2 Antibody - middle region

See related secondary antibodies

Search for all "GPN2 / ATPBD1B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GPN2 / ATPBD1B

Product Description for GPN2 / ATPBD1B

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GPN2 / ATPBD1B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GPN2 / ATPBD1B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP-binding domain 1 family member B, GPN-loop GTPase 2
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H9Y4
Immunogen:
The immunogen for anti-GPN2 antibody: synthetic peptide directed towards the middle region of human GPN2. Synthetic peptide located within the following region: VLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSN.
GeneID:
54707
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GPN2 / ATPBD1B (3 products)

Catalog No. Species Pres. Purity   Source  

GPN2 / ATPBD1B

GPN2 / ATPBD1B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GPN2 / ATPBD1B

GPN2 / ATPBD1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GPN2 / ATPBD1B

GPN2 / ATPBD1B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for GPN2 / ATPBD1B (3 products)

Catalog No. Species Pres. Purity   Source  

ATPBD1B 293T Cell Transient Overexpression Lysate(Denatured)

ATPBD1B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GPN2 Lysate

Western Blot: GPN2 Lysate [NBL1-11237] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GPN2
  Novus Biologicals Inc.

GPN2 overexpression lysate

GPN2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn