TA344948 FBXO34 antibody

Rabbit Polyclonal Anti-FBXO34 Antibody - N-terminal region

See related secondary antibodies

Search for all "FBXO34"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat FBXO34

Product Description for FBXO34

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat FBXO34.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FBXO34

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms F-box only protein 34, FBX34
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NWN3
Immunogen:
The immunogen for anti-Fbxo34 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RDTLRTPMSHGKANGDVKARASYMKPTVLPSASLVKASSRKPFGILSPNV.
GeneID:
55030
Application WB
Background The function of Fbxo34 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FBXO34 (4 products)

Catalog No. Species Pres. Purity   Source  

FBXO34

FBXO34 Human Purified
  Abnova Taiwan Corp.

FBXO34

FBXO34 Human Purified
  Abnova Taiwan Corp.

FBXO34

FBXO34 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FBXO34

FBXO34 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FBXO34 (1 products)

Catalog No. Species Pres. Purity   Source  

FBXO34 293T Cell Transient Overexpression Lysate(Denatured)

FBXO34 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn