TA344956 PINX1 antibody

Rabbit Polyclonal Anti-PINX1 Antibody - N-terminal region

See related secondary antibodies

Search for all "PINX1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat PINX1

Product Description for PINX1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat PINX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PINX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LPTL, LPTS, Liver-related putative tumor suppressor, Pin2-interacting protein X1, Protein 67-11-3, TRF1-interacting protein 1
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96BK5
Immunogen:
The immunogen for anti-PINX1 antibody: synthetic peptide directed towards the N terminal of human PINX1. Synthetic peptide located within the following region: EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF.
GeneID:
54984
Application WB
Background PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. PINX1 inhibits telomerase activity and may inhibit cell proliferation and
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PINX1 (8 products)

Catalog No. Species Pres. Purity   Source  

PINX1

PINX1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PINX1

PINX1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

PINX1 (1-328, His-tag)

PINX1 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

PINX1 (1-328, His-tag)

PINX1 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

PINX1

PINX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PINX1

PINX1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PINX1

PINX1 Human
  Abnova Taiwan Corp.

PINX1

Western Blot: PINX1 Protein [NBC1-26375] Protein
  Novus Biologicals Inc.

Positive controls for PINX1 (2 products)

Catalog No. Species Pres. Purity   Source  

PINX1 Lysate

Western Blot: PINX1 Lysate [NBL1-14430] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PINX1
  Novus Biologicals Inc.

PINX1 overexpression lysate

PINX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn