TA344958 NALP2 antibody

Rabbit Polyclonal Anti-NLRP2 Antibody - C-terminal region

See related secondary antibodies

Search for all "NALP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NALP2

Product Description for NALP2

Rabbit anti Human NALP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NALP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LRR and PYD domains-containing protein 2, NACHT, NBS1, NLRP2, PAN1, PYPAF2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NX02
Immunogen:
The immunogen for anti-NLRP2 antibody: synthetic peptide directed towards the C terminal of human NLRP2. Synthetic peptide located within the following region: FETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWA.
GeneID:
55655
Application WB
Background LP proteins, such as LP2, are characterized by an N-termil pyrin (MIM 608107) domain (PYD) and are involved in the activation of caspase-1 (CASP1; MIM 147678) by Toll-like receptors (see TLR4; MIM 603030). They may also be involved in protein complexes that activate proinflammatory caspases (Tschopp et al., 2003 [PubMed 12563287]).
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NALP2 (8 products)

Catalog No. Species Pres. Purity   Source  

NALP2

NALP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

NALP2

NALP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NALP2

NALP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NALP2

NALP2 Human Purified
  Abnova Taiwan Corp.

NALP2

NALP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

NALP2

NALP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

NALP2

NALP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NALP2

NALP2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NALP2 (2 products)

Catalog No. Species Pres. Purity   Source  

NLRP2 293T Cell Transient Overexpression Lysate(Denatured)

NLRP2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NLRP2 overexpression lysate

NLRP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn