TA344959 COMMD8 antibody

Rabbit Polyclonal Anti-COMMD8 Antibody - middle region

See related secondary antibodies

Search for all "COMMD8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Rat COMMD8

Product Description for COMMD8

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Rat COMMD8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for COMMD8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms COMM domain-containing protein 8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NX08
Immunogen:
The immunogen for anti-COMMD8 antibody: synthetic peptide directed towards the middle region of human COMMD8. Synthetic peptide located within the following region: IAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQL.
GeneID:
54951
Application WB
Background The function of COMMD8 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for COMMD8 (3 products)

Catalog No. Species Pres. Purity   Source  

COMMD8

COMMD8 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

COMMD8

COMMD8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

COMMD8

COMMD8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for COMMD8 (2 products)

Catalog No. Species Pres. Purity   Source  

COMMD8 Lysate

Western Blot: COMMD8 Lysate [NBL1-09371] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for COMMD8
  Novus Biologicals Inc.

COMMD8 overexpression lysate

COMMD8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn