TA344962 CHCHD3 antibody

Rabbit Polyclonal Anti-CHCHD3 Antibody - N-terminal region

See related secondary antibodies

Search for all "CHCHD3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep CHCHD3

Product Description for CHCHD3

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep CHCHD3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CHCHD3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 mitochondrial
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NX63
Immunogen:
The immunogen for anti-CHCHD3 antibody: synthetic peptide directed towards the N terminal of human CHCHD3. Synthetic peptide located within the following region: RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR.
GeneID:
54927
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CHCHD3 (5 products)

Catalog No. Species Pres. Purity   Source  

CHCHD3

CHCHD3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CHCHD3 (1-227, His-tag)

CHCHD3 Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €820.00
  OriGene Technologies GmbH

CHCHD3 (1-227, His-tag)

CHCHD3 Human Purified > 80 % by SDS - PAGE E. coli
20 µg / €320.00
  OriGene Technologies GmbH

CHCHD3

CHCHD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CHCHD3

CHCHD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CHCHD3 (2 products)

Catalog No. Species Pres. Purity   Source  

CHCHD3 293T Cell Transient Overexpression Lysate(Denatured)

CHCHD3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CHCHD3 Lysate

Western Blot: CHCHD3 Lysate [NBL1-09142] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CHCHD3
  Novus Biologicals Inc.
  • LinkedIn