TA344963 OSGEP / GCPL1 antibody

Rabbit Polyclonal Anti-OSGEP Antibody - middle region

See related secondary antibodies

Search for all "OSGEP / GCPL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Mouse, Porcine, Rat, Zebrafish OSGEP / GCPL1

Product Description for OSGEP / GCPL1

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Mouse, Porcine, Rat, Zebrafish OSGEP / GCPL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OSGEP / GCPL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KAE1, PRSMG1, Probable O-sialoglycoprotein endopeptidase
Presentation Purified
Reactivity Bov, Can, GP, Gt, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NPF4
Immunogen:
The immunogen for anti-OSGEP antibody: synthetic peptide directed towards the middle region of human OSGEP. Synthetic peptide located within the following region: EHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVE.
GeneID:
55644
Application WB
Background O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for OSGEP / GCPL1 (5 products)

Catalog No. Species Pres. Purity   Source  

OSGEP / GCPL1

OSGEP / GCPL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

OSGEP / GCPL1 (His-tag)

OSGEP / GCPL1 Human Purified > 80 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

OSGEP / GCPL1 (His-tag)

OSGEP / GCPL1 Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

OSGEP / GCPL1

OSGEP / GCPL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OSGEP / GCPL1

OSGEP / GCPL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for OSGEP / GCPL1 (2 products)

Catalog No. Species Pres. Purity   Source  

OSGEP 293T Cell Transient Overexpression Lysate(Denatured)

OSGEP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

OSGEP Lysate

Western Blot: OSGEP Lysate [NBL1-13999] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for OSGEP
  Novus Biologicals Inc.
  • LinkedIn